PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g22637.1.p
Common NameBRADI_4g22637, LOC100841169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 259aa    MW: 28484.1 Da    PI: 7.959
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g22637.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd  l+ +v+++G+g+W+++++  g+ R+ k+c++rw +yl
  Bradi4g22637.1.p 14 KGPWTLEEDIVLASYVQEHGPGNWRSVPASTGLARCSKSCRLRWVNYL 61
                      79********************************************97 PP

2Myb_DNA-binding50.16.2e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +T++Ed  +v++  +lG++ W++Ia++++ +Rt++++k++w+++l
  Bradi4g22637.1.p  67 RGDFTPQEDSVIVHLQSLLGNR-WAAIASYLP-NRTDNDIKNYWNTHL 112
                       899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.034961IPR017930Myb domain
SuperFamilySSF466895.14E-3110108IPR009057Homeodomain-like
SMARTSM007173.8E-111363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001674.16E-101661No hitNo description
PROSITE profilePS5129424.93662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2465117IPR009057Homeodomain-like
SMARTSM007173.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.6E-1467112IPR001005SANT/Myb domain
CDDcd001677.20E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRPPCCDKM GVKKGPWTLE EDIVLASYVQ EHGPGNWRSV PASTGLARCS KSCRLRWVNY  60
LRPGIRRGDF TPQEDSVIVH LQSLLGNRWA AIASYLPNRT DNDIKNYWNT HLRKRLKKLE  120
AMGAIFALPP QPPESTSTRS SSSSSYAYSV DNISRLLHGF MKTSAPPASA PTKSSQSASY  180
ADAKPSTVVH VIEANEYALP PTFDDYSFSG TGAELINFAG VQQQVSLSSI EKWLFDEAVE  240
TKDELNSSDA SYSVPMLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577718.10.0PREDICTED: myb-related protein 306-like
TrEMBLI1IMM70.0I1IMM7_BRADI; Uncharacterized protein
STRINGBRADI4G22637.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.19e-76myb domain protein 60